Ver mas grande
Adipoq (Rat) Recombinant Protein
AB-P8395
Producto nuevo
Adipoq (Rat) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Adipoq |
| Gene Alias | Acdc|Acrp30 |
| Gene Description | adiponectin, C1Q and collagen domain containing |
| Storage Conditions | Upon reconstitution should be stored at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | GITATEGPGALVPPPKETCAGWMAGIPGYPGHNGIPGRDGRDGTPGEKGEKGDAGVLGPKGDPGDAGMTGAEGPRGFPGTPGRKGEPGEAAYMYHSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSMLLHLEVGDQVWLQVYGEGDNNGLYADNVNDSTFTGFLLYHDTNAAADYKDDDDK. |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Storage Buffer | Lyophilized from 20 mM Tris buffer, 50 mM NaCl, pH 7.5. |
| Gene ID | 246253 |
Más información
Rat Adipoq (Q8K3R4) recombinant protein with FLAG-tag at C-terminal expressed in HEK293 cells.