Adipoq (Rat) Recombinant Protein View larger

Rat Adipoq (Q8K3R4) recombinant protein with FLAG-tag at C-terminal expressed in HEK293 cells.

AB-P8395

New product

Adipoq (Rat) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name Adipoq
Gene Alias Acdc|Acrp30
Gene Description adiponectin, C1Q and collagen domain containing
Storage Conditions Upon reconstitution should be stored at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq GITATEGPGALVPPPKETCAGWMAGIPGYPGHNGIPGRDGRDGTPGEKGEKGDAGVLGPKGDPGDAGMTGAEGPRGFPGTPGRKGEPGEAAYMYHSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSMLLHLEVGDQVWLQVYGEGDNNGLYADNVNDSTFTGFLLYHDTNAAADYKDDDDK.
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from 20 mM Tris buffer, 50 mM NaCl, pH 7.5.
Gene ID 246253

More info

Rat Adipoq (Q8K3R4) recombinant protein with FLAG-tag at C-terminal expressed in HEK293 cells.

Enviar uma mensagem

Rat Adipoq (Q8K3R4) recombinant protein with FLAG-tag at C-terminal expressed in HEK293 cells.

Rat Adipoq (Q8K3R4) recombinant protein with FLAG-tag at C-terminal expressed in HEK293 cells.