ADIPOQ (Pig) ) Recombinant Protein, glycosilated
  • ADIPOQ (Pig) ) Recombinant Protein, glycosilated

ADIPOQ (Pig) ) Recombinant Protein, glycosilated

Ref: AB-P8394
ADIPOQ (Pig) ) Recombinant Protein, glycosilated

Información del producto

Pig ADIPOQ (Q7YRF8) recombinant protein with FLAG-tag at N-terminal expressed in HEK293 cells.
Información adicional
Size 2 x 10 ug
Gene Name ADIPOQ
Gene Alias ACRP30|ADN|APM1
Gene Description adiponectin, C1Q and collagen domain containing
Storage Conditions For long term, store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq HVDYKDDDDKPAGETTEKPGALLPMPKGACAGWMAGIPGHPGHNGTPGRDGRDGVPGEKGEKGDTGLTGPKGDTGESGVTGVEGPRGFPGIPGRKGEPGESAYVYRSAFSVGLETRVTVPNMPIRFTKIFYNQQNHYDVTTGKFHCNIPGLYYFSFHITVLKDVKVSLYKDKAVLFTYDQQDKNVDQASGVLLYLEKGDQWLQAYGDEENGVYADNVNDSFTGFLLYHNIE.
Form Lyophilized
Antigen species Target species Pig
Storage Buffer Lyophilized from 20mM Tris buffer and 50mM NaCl pH-7.5.
Gene ID 397660

Enviar un mensaje


ADIPOQ (Pig) ) Recombinant Protein, glycosilated

ADIPOQ (Pig) ) Recombinant Protein, glycosilated