Ver mas grande
ADIPOQ (Pig) ) Recombinant Protein, glycosilated
AB-P8394
Producto nuevo
ADIPOQ (Pig) ) Recombinant Protein, glycosilated
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | ADIPOQ |
| Gene Alias | ACRP30|ADN|APM1 |
| Gene Description | adiponectin, C1Q and collagen domain containing |
| Storage Conditions | For long term, store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | HVDYKDDDDKPAGETTEKPGALLPMPKGACAGWMAGIPGHPGHNGTPGRDGRDGVPGEKGEKGDTGLTGPKGDTGESGVTGVEGPRGFPGIPGRKGEPGESAYVYRSAFSVGLETRVTVPNMPIRFTKIFYNQQNHYDVTTGKFHCNIPGLYYFSFHITVLKDVKVSLYKDKAVLFTYDQQDKNVDQASGVLLYLEKGDQWLQAYGDEENGVYADNVNDSFTGFLLYHNIE. |
| Form | Lyophilized |
| Antigen species Target species | Pig |
| Storage Buffer | Lyophilized from 20mM Tris buffer and 50mM NaCl pH-7.5. |
| Gene ID | 397660 |
Más información
Pig ADIPOQ (Q7YRF8) recombinant protein with FLAG-tag at N-terminal expressed in HEK293 cells.