ADIPOQ (Pig) ) Recombinant Protein, glycosilated View larger

Pig ADIPOQ (Q7YRF8) recombinant protein with FLAG-tag at N-terminal expressed in HEK293 cells.

AB-P8394

New product

ADIPOQ (Pig) ) Recombinant Protein, glycosilated

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name ADIPOQ
Gene Alias ACRP30|ADN|APM1
Gene Description adiponectin, C1Q and collagen domain containing
Storage Conditions For long term, store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq HVDYKDDDDKPAGETTEKPGALLPMPKGACAGWMAGIPGHPGHNGTPGRDGRDGVPGEKGEKGDTGLTGPKGDTGESGVTGVEGPRGFPGIPGRKGEPGESAYVYRSAFSVGLETRVTVPNMPIRFTKIFYNQQNHYDVTTGKFHCNIPGLYYFSFHITVLKDVKVSLYKDKAVLFTYDQQDKNVDQASGVLLYLEKGDQWLQAYGDEENGVYADNVNDSFTGFLLYHNIE.
Form Lyophilized
Antigen species Target species Pig
Storage Buffer Lyophilized from 20mM Tris buffer and 50mM NaCl pH-7.5.
Gene ID 397660

More info

Pig ADIPOQ (Q7YRF8) recombinant protein with FLAG-tag at N-terminal expressed in HEK293 cells.

Enviar uma mensagem

Pig ADIPOQ (Q7YRF8) recombinant protein with FLAG-tag at N-terminal expressed in HEK293 cells.

Pig ADIPOQ (Q7YRF8) recombinant protein with FLAG-tag at N-terminal expressed in HEK293 cells.