IL17A (Canine) Recombinant Protein
  • IL17A (Canine) Recombinant Protein

IL17A (Canine) Recombinant Protein

Ref: AB-P8359
IL17A (Canine) Recombinant Protein

Información del producto

Canine IL17A (C6L8D7, 29 a.a. - 155 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Información adicional
Size 2 x 10 ug
Gene Name IL17A
Gene Alias -
Gene Description interleukin 17A
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq FPQNPGCRNTEDKNFPQHVKVNLNILNRNTNSRRPSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNNEGNINYHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHVAHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 481837

Enviar un mensaje


IL17A (Canine) Recombinant Protein

IL17A (Canine) Recombinant Protein