View larger
Canine IL17A (C6L8D7, 29 a.a. - 155 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
AB-P8359
New product
IL17A (Canine) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | IL17A |
| Gene Alias | - |
| Gene Description | interleukin 17A |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | FPQNPGCRNTEDKNFPQHVKVNLNILNRNTNSRRPSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNNEGNINYHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHVAHHHHHH |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (10% glycerol) |
| Gene ID | 481837 |
More info
Canine IL17A (C6L8D7, 29 a.a. - 155 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.