Il15 (Mouse) Recombinant Protein
  • Il15 (Mouse) Recombinant Protein

Il15 (Mouse) Recombinant Protein

Ref: AB-P8348
Il15 (Mouse) Recombinant Protein

Información del producto

Mouse Il15 (P48346, 49 a.a. - 162 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Il15
Gene Alias AI503618
Gene Description interleukin 15
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMNWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILH_x005F_x000D__x000D_EYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 16168

Enviar un mensaje


Il15 (Mouse) Recombinant Protein

Il15 (Mouse) Recombinant Protein