View larger
Mouse Il15 (P48346, 49 a.a. - 162 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli<
AB-P8348
New product
Il15 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | Il15 |
| Gene Alias | AI503618 |
| Gene Description | interleukin 15 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMNWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILH_x005F_x000D__x000D_EYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (10% glycerol) |
| Gene ID | 16168 |
More info
Mouse Il15 (P48346, 49 a.a. - 162 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.