IL13 (Human) Recombinant Protein
  • IL13 (Human) Recombinant Protein

IL13 (Human) Recombinant Protein

Ref: AB-P8338
IL13 (Human) Recombinant Protein

Información del producto

Human IL13 (P35225, 21 a.a. - 132 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name IL13
Gene Alias ALRH|BHR1|IL-13|MGC116786|MGC116788|MGC116789|P600
Gene Description interleukin 13
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq TVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDL
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 25mM Na-Acetate pH 4.8 (50% glycerol)
Gene ID 3596

Enviar un mensaje


IL13 (Human) Recombinant Protein

IL13 (Human) Recombinant Protein