View larger
Human IL13 (P35225, 21 a.a. - 132 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli<
AB-P8338
New product
IL13 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | IL13 |
| Gene Alias | ALRH|BHR1|IL-13|MGC116786|MGC116788|MGC116789|P600 |
| Gene Description | interleukin 13 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | TVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDL |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 25mM Na-Acetate pH 4.8 (50% glycerol) |
| Gene ID | 3596 |
More info
Human IL13 (P35225, 21 a.a. - 132 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.