IL6ST (Human) Recombinant Protein
  • IL6ST (Human) Recombinant Protein

IL6ST (Human) Recombinant Protein

Ref: AB-P8300
IL6ST (Human) Recombinant Protein

Información del producto

Human IL6ST (Q17RA0, 23 a.a. - 619 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 5 ug
Gene Name IL6ST
Gene Alias CD130|CDw130|GP130|GP130-RAPS|IL6R-beta
Gene Description interleukin 6 signal transducer (gp130, oncostatin M receptor)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKMRCEWDRGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDT
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 3572

Enviar un mensaje


IL6ST (Human) Recombinant Protein

IL6ST (Human) Recombinant Protein