View larger
Human IL6ST (Q17RA0, 23 a.a. - 619 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
AB-P8300
New product
IL6ST (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 5 ug |
| Gene Name | IL6ST |
| Gene Alias | CD130|CDw130|GP130|GP130-RAPS|IL6R-beta |
| Gene Description | interleukin 6 signal transducer (gp130, oncostatin M receptor) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKMRCEWDRGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDT |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In PBS pH 7.4 (10% glycerol) |
| Gene ID | 3572 |
More info
Human IL6ST (Q17RA0, 23 a.a. - 619 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.