IL4R (Human) Recombinant Protein
  • IL4R (Human) Recombinant Protein

IL4R (Human) Recombinant Protein

Ref: AB-P8275
IL4R (Human) Recombinant Protein

Información del producto

Human IL4R (P24394, 26 a.a. - 232 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Información adicional
Size 15 ug
Gene Name IL4R
Gene Alias CD124|IL4RA
Gene Description interleukin 4 receptor
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHLEHHHHHH
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4
Gene ID 3566

Enviar un mensaje


IL4R (Human) Recombinant Protein

IL4R (Human) Recombinant Protein