IL4R (Human) Recombinant Protein View larger

Human IL4R (P24394, 26 a.a. - 232 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.

AB-P8275

New product

IL4R (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 15 ug
Gene Name IL4R
Gene Alias CD124|IL4RA
Gene Description interleukin 4 receptor
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHLEHHHHHH
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4
Gene ID 3566

More info

Human IL4R (P24394, 26 a.a. - 232 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.

Enviar uma mensagem

Human IL4R (P24394, 26 a.a. - 232 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.

Human IL4R (P24394, 26 a.a. - 232 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.