Il1rn (Mouse) Recombinant Protein Ver mas grande

Il1rn (Mouse) Recombinant Protein

AB-P8233

Producto nuevo

Il1rn (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name Il1rn
Gene Alias F630041P17Rik|IL-1ra
Gene Description interleukin 1 receptor antagonist
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq ACRPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 16181

Más información

Mouse Il1rn (P25085, 25 a.a. - 178 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Il1rn (Mouse) Recombinant Protein

Il1rn (Mouse) Recombinant Protein