Il1rn (Mouse) Recombinant Protein
  • Il1rn (Mouse) Recombinant Protein

Il1rn (Mouse) Recombinant Protein

Ref: AB-P8233
Il1rn (Mouse) Recombinant Protein

Información del producto

Mouse Il1rn (P25085, 25 a.a. - 178 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Il1rn
Gene Alias F630041P17Rik|IL-1ra
Gene Description interleukin 1 receptor antagonist
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ACRPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 16181

Enviar uma mensagem


Il1rn (Mouse) Recombinant Protein

Il1rn (Mouse) Recombinant Protein