IGFBP6 (Human) Recombinant Protein Ver mas grande

IGFBP6 (Human) Recombinant Protein

AB-P8197

Producto nuevo

IGFBP6 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name IGFBP6
Gene Alias IBP6
Gene Description insulin-like growth factor binding protein 6
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq SQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
Form Lyophilized
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is &gt
Gene ID 3489

Más información

Human IGFBP6 (P24592, 148 a.a. - 240 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.

Consulta sobre un producto

IGFBP6 (Human) Recombinant Protein

IGFBP6 (Human) Recombinant Protein