View larger
Human IGFBP6 (P24592, 148 a.a. - 240 a.a.) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P8197
New product
IGFBP6 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | IGFBP6 |
| Gene Alias | IBP6 |
| Gene Description | insulin-like growth factor binding protein 6 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | SQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | Lyophilized from sterile distilled Water is > |
| Gene ID | 3489 |
More info
Human IGFBP6 (P24592, 148 a.a. - 240 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.