PDGFA/PDGFB (Human) Recombinant Protein Ver mas grande

PDGFA/PDGFB (Human) Recombinant Protein

AB-P8129

Producto nuevo

PDGFA/PDGFB (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name PDGFA
Gene Alias PDGF-A|PDGF1
Gene Description platelet-derived growth factor alpha polypeptide
Storage Conditions Lyophilized although stable at room temperature for 3 weeks, should be stored desiccated below -20ºC. Upon reconstitution should be stored at 4ºC between 2-7 days and for future use below -20ºC.<br>Aliquot to avoid repeated freezing and thawing._x005F_x00
Immunogen Prot. Seq PDGFA:MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT.<br>_x005F_x005F_x005F_x000D__x005F_x000D_PDGFB: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVR
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 10mM AcOH
Gene ID 5154|5155

Más información

Human PDGFA/PDGFB (P01127|P04085) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

PDGFA/PDGFB (Human) Recombinant Protein

PDGFA/PDGFB (Human) Recombinant Protein