PDGFA/PDGFB (Human) Recombinant Protein
  • PDGFA/PDGFB (Human) Recombinant Protein

PDGFA/PDGFB (Human) Recombinant Protein

Ref: AB-P8129
PDGFA/PDGFB (Human) Recombinant Protein

Información del producto

Human PDGFA/PDGFB (P01127|P04085) recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name PDGFA
Gene Alias PDGF-A|PDGF1
Gene Description platelet-derived growth factor alpha polypeptide
Storage Conditions Lyophilized although stable at room temperature for 3 weeks, should be stored desiccated below -20C. Upon reconstitution should be stored at 4C between 2-7 days and for future use below -20C.
Aliquot to avoid repeated freezing and thawing._x005F_x005F_
Application Key Func,SDS-PAGE
Immunogen Prot. Seq PDGFA:MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT.
_x005F_x005F_x005F_x000D__x005F_x000D_PDGFB: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVR
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 10mM AcOH
Gene ID 5154|5155

Enviar uma mensagem


PDGFA/PDGFB (Human) Recombinant Protein

PDGFA/PDGFB (Human) Recombinant Protein