Ver mas grande
FGF2 (Human) Recombinant Protein
AB-P8121
Producto nuevo
FGF2 (Human) Recombinant Protein
Comprando este producto generará 15 Biopuntos. Su cesta contiene un total 15 Biopuntos puede ser convertido en un Biobonos Descuento 60.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | FGF2 |
| Gene Alias | BFGF|FGFB|HBGF-2 |
| Gene Description | fibroblast growth factor 2 (basic) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/ml |
| Gene ID | 2247 |
Más información
Human FGF2 (P09038, 142 a.a. - 288 a.a.) partial length recombinant protein expressed in Escherichia coli.