View larger
Human FGF2 (P09038, 142 a.a. - 288 a.a.) partial length recombinant protein expressed in <i>Escherichia coli</i>.
AB-P8121
New product
FGF2 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 15 pontos de fidelização. Seu carrinho totalizará 15 pontos de fidelização que podem ser convertidos num vale de desconto de 60.00EUR.
Data sheet
| Size | 1 mg |
| Gene Name | FGF2 |
| Gene Alias | BFGF|FGFB|HBGF-2 |
| Gene Description | fibroblast growth factor 2 (basic) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/ml |
| Gene ID | 2247 |
More info
Human FGF2 (P09038, 142 a.a. - 288 a.a.) partial length recombinant protein expressed in Escherichia coli.