FAP (Human) Recombinant Protein Ver mas grande

FAP (Human) Recombinant Protein

AB-P8092

Producto nuevo

FAP (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 9 Biopuntos. Su cesta contiene un total 9 Biopuntos puede ser convertido en un Biobonos Descuento 36.00EUR.


Hoja técnica

Size 100 ug
Gene Name FAP
Gene Alias DKFZp686G13158|DPPIV|FAPA
Gene Description fibroblast activation protein, alpha
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq LRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYGDEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEV
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (20% glycerol)
Gene ID 2191

Más información

Human FAP (Q12884, 26 a.a. - 760 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.

Consulta sobre un producto

FAP (Human) Recombinant Protein

FAP (Human) Recombinant Protein