FAP (Human) Recombinant Protein
  • FAP (Human) Recombinant Protein

FAP (Human) Recombinant Protein

Ref: AB-P8092
FAP (Human) Recombinant Protein

Información del producto

Human FAP (Q12884, 26 a.a. - 760 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name FAP
Gene Alias DKFZp686G13158|DPPIV|FAPA
Gene Description fibroblast activation protein, alpha
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYGDEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEV
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (20% glycerol)
Gene ID 2191

Enviar uma mensagem


FAP (Human) Recombinant Protein

FAP (Human) Recombinant Protein