View larger
Human FAP (Q12884, 26 a.a. - 760 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
AB-P8092
New product
FAP (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 9 pontos de fidelização. Seu carrinho totalizará 9 pontos de fidelização que podem ser convertidos num vale de desconto de 36.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | FAP |
| Gene Alias | DKFZp686G13158|DPPIV|FAPA |
| Gene Description | fibroblast activation protein, alpha |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | LRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYGDEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEV |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In Phosphate-Buffer Saline pH 7.4 (20% glycerol) |
| Gene ID | 2191 |
More info
Human FAP (Q12884, 26 a.a. - 760 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.