IL5 (Canine) Recombinant Protein
  • IL5 (Canine) Recombinant Protein

IL5 (Canine) Recombinant Protein

Ref: AB-P8090
IL5 (Canine) Recombinant Protein

Información del producto

Canine IL5 (Q95J76, 22 a.a. - 134 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name IL5
Gene Alias -
Gene Description interleukin 5 (colony-stimulating factor, eosinophil)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 403790

Enviar un mensaje


IL5 (Canine) Recombinant Protein

IL5 (Canine) Recombinant Protein