View larger
Canine IL5 (Q95J76, 22 a.a. - 134 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
AB-P8090
New product
IL5 (Canine) Recombinant Protein
Ao comprar este produto pode ganhar até 8 pontos de fidelização. Seu carrinho totalizará 8 pontos de fidelização que podem ser convertidos num vale de desconto de 32.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | IL5 |
| Gene Alias | - |
| Gene Description | interleukin 5 (colony-stimulating factor, eosinophil) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In Phosphate-Buffer Saline pH 7.4 (10% glycerol) |
| Gene ID | 403790 |
More info
Canine IL5 (Q95J76, 22 a.a. - 134 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.