Ver mas grande
LILRB1 (Human) Recombinant Protein
AB-P8083
Producto nuevo
LILRB1 (Human) Recombinant Protein
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | LILRB1 |
| Gene Alias | CD85|CD85J|FLJ37515|ILT2|LIR-1|LIR1|MIR-7|MIR7 |
| Gene Description | leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLS |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In Phosphate-Buffer Saline pH 7.4 (10% glycerol) |
| Gene ID | 10859 |
Más información
Human LILRB1 (Q8NHL6, 24 a.a. - 461 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.