LILRB1 (Human) Recombinant Protein
  • LILRB1 (Human) Recombinant Protein

LILRB1 (Human) Recombinant Protein

Ref: AB-P8083
LILRB1 (Human) Recombinant Protein

Información del producto

Human LILRB1 (Q8NHL6, 24 a.a. - 461 a.a.) partial length recombinant protein His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name LILRB1
Gene Alias CD85|CD85J|FLJ37515|ILT2|LIR-1|LIR1|MIR-7|MIR7
Gene Description leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLS
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 10859

Enviar uma mensagem


LILRB1 (Human) Recombinant Protein

LILRB1 (Human) Recombinant Protein