IL22 (Human) Recombinant Protein
  • IL22 (Human) Recombinant Protein

IL22 (Human) Recombinant Protein

Ref: AB-P8054
IL22 (Human) Recombinant Protein

Información del producto

Human IL22 (Q9GZX6, 34 a.a. - 179 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 50 ug
Gene Name IL22
Gene Alias IL-21|IL-22|IL-D110|IL-TIF|IL21|ILTIF|MGC79382|MGC79384|TIFIL-23|TIFa|zcyto18
Gene Description interleukin 22
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 50616

Enviar un mensaje


IL22 (Human) Recombinant Protein

IL22 (Human) Recombinant Protein