IL22 (Human) Recombinant Protein View larger

Human IL22 (Q9GZX6, 34 a.a. - 179 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression syst

AB-P8054

New product

IL22 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 7 pontos de fidelização. Seu carrinho totalizará 7 pontos de fidelização que podem ser convertidos num vale de desconto de 28.00EUR.


Data sheet

Size 50 ug
Gene Name IL22
Gene Alias IL-21|IL-22|IL-D110|IL-TIF|IL21|ILTIF|MGC79382|MGC79384|TIFIL-23|TIFa|zcyto18
Gene Description interleukin 22
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 50616

More info

Human IL22 (Q9GZX6, 34 a.a. - 179 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.

Enviar uma mensagem

Human IL22 (Q9GZX6, 34 a.a. - 179 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression syst

Human IL22 (Q9GZX6, 34 a.a. - 179 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression syst