IL1R2 (Human) Recombinant Protein Ver mas grande

IL1R2 (Human) Recombinant Protein

AB-P8040

Producto nuevo

IL1R2 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 7 Biopuntos. Su cesta contiene un total 7 Biopuntos puede ser convertido en un Biobonos Descuento 28.00EUR.


Hoja técnica

Size 100 ug
Gene Name IL1R2
Gene Alias CD121b|IL1RB|MGC47725
Gene Description interleukin 1 receptor, type II
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq FTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDNEKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVIISPLKTISASLGSRLTIPCKVFLGTGTPL
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 7850

Más información

Human IL1R2 (P27930, 14 a.a. - 343 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.

Consulta sobre un producto

IL1R2 (Human) Recombinant Protein

IL1R2 (Human) Recombinant Protein