IL1R2 (Human) Recombinant Protein
  • IL1R2 (Human) Recombinant Protein

IL1R2 (Human) Recombinant Protein

Ref: AB-P8040
IL1R2 (Human) Recombinant Protein

Información del producto

Human IL1R2 (P27930, 14 a.a. - 343 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name IL1R2
Gene Alias CD121b|IL1RB|MGC47725
Gene Description interleukin 1 receptor, type II
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq FTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDNEKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVIISPLKTISASLGSRLTIPCKVFLGTGTPL
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 7850

Enviar un mensaje


IL1R2 (Human) Recombinant Protein

IL1R2 (Human) Recombinant Protein