View larger
Human IL1R2 (P27930, 14 a.a. - 343 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression sys
AB-P8040
New product
IL1R2 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 7 pontos de fidelização. Seu carrinho totalizará 7 pontos de fidelização que podem ser convertidos num vale de desconto de 28.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | IL1R2 |
| Gene Alias | CD121b|IL1RB|MGC47725 |
| Gene Description | interleukin 1 receptor, type II |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | FTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDNEKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVIISPLKTISASLGSRLTIPCKVFLGTGTPL |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In Phosphate-Buffer Saline pH 7.4 (10% glycerol) |
| Gene ID | 7850 |
More info
Human IL1R2 (P27930, 14 a.a. - 343 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.