Ver mas grande
IL15RA (Human) Recombinant Protein
AB-P8028
Producto nuevo
IL15RA (Human) Recombinant Protein
Comprando este producto generará 7 Biopuntos. Su cesta contiene un total 7 Biopuntos puede ser convertido en un Biobonos Descuento 28.00EUR.
Hoja técnica
| Size | 250 ug |
| Gene Name | IL15RA |
| Gene Alias | MGC104179 |
| Gene Description | interleukin 15 receptor, alpha |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In Phosphate-Buffer Saline pH 7.4 (10% glycerol) |
| Gene ID | 3601 |
Más información
Human IL15RA (Q13261, 31 a.a. - 205 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.