IL15RA (Human) Recombinant Protein
  • IL15RA (Human) Recombinant Protein

IL15RA (Human) Recombinant Protein

Ref: AB-P8028
IL15RA (Human) Recombinant Protein

Información del producto

Human IL15RA (Q13261, 31 a.a. - 205 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.
Información adicional
Size 250 ug
Gene Name IL15RA
Gene Alias MGC104179
Gene Description interleukin 15 receptor, alpha
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 3601

Enviar uma mensagem


IL15RA (Human) Recombinant Protein

IL15RA (Human) Recombinant Protein