PPP1CC (Human) Recombinant Protein
  • PPP1CC (Human) Recombinant Protein

PPP1CC (Human) Recombinant Protein

Ref: AB-P8011
PPP1CC (Human) Recombinant Protein

Información del producto

Human PPP1CC (P36873, 1 a.a. - 323 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name PPP1CC
Gene Alias PPP1G
Gene Description protein phosphatase 1, catalytic subunit, gamma isoform
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGY
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (50% glycerol, 0.2 M NaCl, 2 mM DTT)
Gene ID 5501

Enviar un mensaje


PPP1CC (Human) Recombinant Protein

PPP1CC (Human) Recombinant Protein