View larger
Human PPP1CC (P36873, 1 a.a. - 323 a.a.) full length recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P8011
New product
PPP1CC (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | PPP1CC |
| Gene Alias | PPP1G |
| Gene Description | protein phosphatase 1, catalytic subunit, gamma isoform |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGY |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (50% glycerol, 0.2 M NaCl, 2 mM DTT) |
| Gene ID | 5501 |
More info
Human PPP1CC (P36873, 1 a.a. - 323 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.