CD244 (Human) Recombinant Protein
  • CD244 (Human) Recombinant Protein

CD244 (Human) Recombinant Protein

Ref: AB-P8009
CD244 (Human) Recombinant Protein

Información del producto

Human CD244 (Q9BZW8, 19 a.a. - 224 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.
Información adicional
Size 100 ug
Gene Name CD244
Gene Alias 2B4|NAIL|NKR2B4|Nmrk|SLAMF4
Gene Description CD244 molecule, natural killer cell receptor 2B4
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQE
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 51744

Enviar un mensaje


CD244 (Human) Recombinant Protein

CD244 (Human) Recombinant Protein