CD244 (Human) Recombinant Protein View larger

Human CD244 (Q9BZW8, 19 a.a. - 224 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expressio

AB-P8009

New product

CD244 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 ug
Gene Name CD244
Gene Alias 2B4|NAIL|NKR2B4|Nmrk|SLAMF4
Gene Description CD244 molecule, natural killer cell receptor 2B4
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq GKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQE
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 51744

More info

Human CD244 (Q9BZW8, 19 a.a. - 224 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.

Enviar uma mensagem

Human CD244 (Q9BZW8, 19 a.a. - 224 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expressio

Human CD244 (Q9BZW8, 19 a.a. - 224 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expressio