Gpt (Mouse) Recombinant Protein
  • Gpt (Mouse) Recombinant Protein

Gpt (Mouse) Recombinant Protein

Ref: AB-P8007
Gpt (Mouse) Recombinant Protein

Información del producto

Mouse Gpt (Q8QZR5, 1 a.a. - 496 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Gpt
Gene Alias 1300007J06Rik|2310022B03Rik|ALT|Gpt-1|Gpt1
Gene Description glutamic pyruvic transaminase, soluble
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MASQRNDRIQASRNGLKGKVLTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSLGAYSISSGIQPIREDVAQYIERRDGGIPADPNNIFLSTGASDAIVTMLKLLVAGEGRARTGVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWALDIAELRRALCQARDRCCPRVLCVINPGNPTGQVQTRECI
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol, 1 mM DTT)
Gene ID 76282

Enviar un mensaje


Gpt (Mouse) Recombinant Protein

Gpt (Mouse) Recombinant Protein