Gpt (Mouse) Recombinant Protein View larger

Mouse Gpt (Q8QZR5, 1 a.a. - 496 a.a.) full length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P8007

New product

Gpt (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 100 ug
Gene Name Gpt
Gene Alias 1300007J06Rik|2310022B03Rik|ALT|Gpt-1|Gpt1
Gene Description glutamic pyruvic transaminase, soluble
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MASQRNDRIQASRNGLKGKVLTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSLGAYSISSGIQPIREDVAQYIERRDGGIPADPNNIFLSTGASDAIVTMLKLLVAGEGRARTGVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWALDIAELRRALCQARDRCCPRVLCVINPGNPTGQVQTRECI
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol, 1 mM DTT)
Gene ID 76282

More info

Mouse Gpt (Q8QZR5, 1 a.a. - 496 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Mouse Gpt (Q8QZR5, 1 a.a. - 496 a.a.) full length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Mouse Gpt (Q8QZR5, 1 a.a. - 496 a.a.) full length recombinant protein with His tag expressed in <i>Escherichia coli</i>.