Ppif (Rat) Recombinant Protein Ver mas grande

Ppif (Rat) Recombinant Protein

AB-P8000

Producto nuevo

Ppif (Rat) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 100 ug
Gene Name Ppif
Gene Alias MGC93084|PPIase
Gene Description peptidylprolyl isomerase F (cyclophilin F)
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq CSDGGARGANSSSQNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQLS
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol, 1 mM DTT)
Gene ID 282819

Más información

Rat Ppif (P29117, 30 a.a. - 206 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.

Consulta sobre un producto

Ppif (Rat) Recombinant Protein

Ppif (Rat) Recombinant Protein