View larger
Rat Ppif (P29117, 30 a.a. - 206 a.a.) partial length recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P8000
New product
Ppif (Rat) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | Ppif |
| Gene Alias | MGC93084|PPIase |
| Gene Description | peptidylprolyl isomerase F (cyclophilin F) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | CSDGGARGANSSSQNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQLS |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In Phosphate-Buffer Saline pH 7.4 (10% glycerol, 1 mM DTT) |
| Gene ID | 282819 |
More info
Rat Ppif (P29117, 30 a.a. - 206 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.