Ppif (Rat) Recombinant Protein
  • Ppif (Rat) Recombinant Protein

Ppif (Rat) Recombinant Protein

Ref: AB-P8000
Ppif (Rat) Recombinant Protein

Información del producto

Rat Ppif (P29117, 30 a.a. - 206 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Ppif
Gene Alias MGC93084|PPIase
Gene Description peptidylprolyl isomerase F (cyclophilin F)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq CSDGGARGANSSSQNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQLS
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol, 1 mM DTT)
Gene ID 282819

Enviar uma mensagem


Ppif (Rat) Recombinant Protein

Ppif (Rat) Recombinant Protein