Ppif (Rat) Recombinant Protein View larger

Rat Ppif (P29117, 30 a.a. - 206 a.a.) partial length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P8000

New product

Ppif (Rat) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 100 ug
Gene Name Ppif
Gene Alias MGC93084|PPIase
Gene Description peptidylprolyl isomerase F (cyclophilin F)
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq CSDGGARGANSSSQNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQLS
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol, 1 mM DTT)
Gene ID 282819

More info

Rat Ppif (P29117, 30 a.a. - 206 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Rat Ppif (P29117, 30 a.a. - 206 a.a.) partial length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Rat Ppif (P29117, 30 a.a. - 206 a.a.) partial length recombinant protein with His tag expressed in <i>Escherichia coli</i>.