ULBP1 (Human) Recombinant Protein Ver mas grande

ULBP1 (Human) Recombinant Protein

AB-P7994

Producto nuevo

ULBP1 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Hoja técnica

Size 100 ug
Gene Name ULBP1
Gene Alias RAET1I
Gene Description UL16 binding protein 1
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 80329

Más información

Human ULBP1 (Q9BZM6, 26 a.a. - 216 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.

Consulta sobre un producto

ULBP1 (Human) Recombinant Protein

ULBP1 (Human) Recombinant Protein