ULBP1 (Human) Recombinant Protein View larger

Human ULBP1 (Q9BZM6, 26 a.a. - 216 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression sys

AB-P7994

New product

ULBP1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 100 ug
Gene Name ULBP1
Gene Alias RAET1I
Gene Description UL16 binding protein 1
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 80329

More info

Human ULBP1 (Q9BZM6, 26 a.a. - 216 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.

Enviar uma mensagem

Human ULBP1 (Q9BZM6, 26 a.a. - 216 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression sys

Human ULBP1 (Q9BZM6, 26 a.a. - 216 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression sys