GLUL (Human) Recombinant Protein
  • GLUL (Human) Recombinant Protein

GLUL (Human) Recombinant Protein

Ref: AB-P7988
GLUL (Human) Recombinant Protein

Información del producto

Human GLUL (P15104, 1 a.a. - 373 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name GLUL
Gene Alias GLNS|GS|PIG43|PIG59
Gene Description glutamate-ammonia ligase (glutamine synthetase)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTN
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (20% glycerol, 200 mM NaCl, 5 mM DTT)
Gene ID 2752

Enviar un mensaje


GLUL (Human) Recombinant Protein

GLUL (Human) Recombinant Protein