GLUL (Human) Recombinant Protein View larger

Human GLUL (P15104, 1 a.a. - 373 a.a.) full length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P7988

New product

GLUL (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 100 ug
Gene Name GLUL
Gene Alias GLNS|GS|PIG43|PIG59
Gene Description glutamate-ammonia ligase (glutamine synthetase)
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTN
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (20% glycerol, 200 mM NaCl, 5 mM DTT)
Gene ID 2752

More info

Human GLUL (P15104, 1 a.a. - 373 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Human GLUL (P15104, 1 a.a. - 373 a.a.) full length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Human GLUL (P15104, 1 a.a. - 373 a.a.) full length recombinant protein with His tag expressed in <i>Escherichia coli</i>.