Ces2e (Mouse) Recombinant Protein Ver mas grande

Ces2e (Mouse) Recombinant Protein

AB-P7967

Producto nuevo

Ces2e (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 11 Biopuntos. Su cesta contiene un total 11 Biopuntos puede ser convertido en un Biobonos Descuento 44.00EUR.


Hoja técnica

Size 250 ug
Gene Name Ces5
Gene Alias 9030624L02Rik
Gene Description carboxylesterase 5
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QDSASPIRNTHTGQVRGSLVHVKDTDIAVHTFLGIPFAKPPVGPLRFAPPEAPEPWSGVRDGTSHPNMCLQNDNLMGSEDLKMMNLILPPISMSEDCLYLNIYVPAHAHEGSNLPVMVWIHGGALTVGMASMYDGSMLAATEDVVVVAIQYRLGVLGFFSTGDQHAKGNWGYLDQVAALRWVQQNIVHFGGNPDRVTIFGESAGGTSVSSHVVSPMSQGLFHGAIMESGVAVLPDLISSSSEMVHRIVANLSGCA
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 234673

Más información

Mouse Ces2e (Q8BK48, 27 a.a. - 559 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.

Consulta sobre un producto

Ces2e (Mouse) Recombinant Protein

Ces2e (Mouse) Recombinant Protein