Ces2e (Mouse) Recombinant Protein
  • Ces2e (Mouse) Recombinant Protein

Ces2e (Mouse) Recombinant Protein

Ref: AB-P7967
Ces2e (Mouse) Recombinant Protein

Información del producto

Mouse Ces2e (Q8BK48, 27 a.a. - 559 a.a.) partial length recombinant protein with His tag expressed in Baculovirus expression system.
Información adicional
Size 250 ug
Gene Name Ces5
Gene Alias 9030624L02Rik
Gene Description carboxylesterase 5
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QDSASPIRNTHTGQVRGSLVHVKDTDIAVHTFLGIPFAKPPVGPLRFAPPEAPEPWSGVRDGTSHPNMCLQNDNLMGSEDLKMMNLILPPISMSEDCLYLNIYVPAHAHEGSNLPVMVWIHGGALTVGMASMYDGSMLAATEDVVVVAIQYRLGVLGFFSTGDQHAKGNWGYLDQVAALRWVQQNIVHFGGNPDRVTIFGESAGGTSVSSHVVSPMSQGLFHGAIMESGVAVLPDLISSSSEMVHRIVANLSGCA
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 234673

Enviar uma mensagem


Ces2e (Mouse) Recombinant Protein

Ces2e (Mouse) Recombinant Protein