AB-P7938
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Size | 100 ug |
Gene Name | PDIA3 |
Gene Alias | ER60|ERp57|ERp60|ERp61|GRP57|GRP58|HsT17083|P58|PI-PLC |
Gene Description | protein disulfide isomerase family A, member 3 |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | SDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYW |
Form | Liquid |
Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
Storage Buffer | In 20mM Tris-HCl pH 8.0 (10% glycerol, 0.1 M NaCl, 1 mM DTT) |
Gene ID | 2923 |