PDIA3 (Human) Recombinant Protein
  • PDIA3 (Human) Recombinant Protein

PDIA3 (Human) Recombinant Protein

Ref: AB-P7938
PDIA3 (Human) Recombinant Protein

Información del producto

Human PDIA3 (P30101, 25 a.a. - 505 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name PDIA3
Gene Alias ER60|ERp57|ERp60|ERp61|GRP57|GRP58|HsT17083|P58|PI-PLC
Gene Description protein disulfide isomerase family A, member 3
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYW
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (10% glycerol, 0.1 M NaCl, 1 mM DTT)
Gene ID 2923

Enviar uma mensagem


PDIA3 (Human) Recombinant Protein

PDIA3 (Human) Recombinant Protein